Structure of PDB 4v63 Chain D6

Receptor sequence
>4v63D6 (length=44) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
LLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHREV
3D structure
PDB4v63 Structural basis for translation termination on the 70S ribosome
ChainD6
Resolution3.207 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D6 R19 Y21 T23 E24 K25 K27 T30 E35 R37 Y39 W42 K45 H46 R11 Y13 T15 E16 K17 K19 T22 E27 R29 Y31 W34 K37 H38
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v63, PDBe:4v63, PDBj:4v63
PDBsum4v63
PubMed18596689
UniProtQ72GW3|RL33_THET2 Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]