Structure of PDB 5m1j Chain D5

Receptor sequence

>5m1jD5 (length=296) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

AFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRL
VVRFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYAT
GLLIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQ
RTTTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFG
GHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADP
AFKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ

3D structure

PDB

5m1j Structural insights into ribosomal rescue by Dom34 and Hbs1 at near-atomic resolution.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D5	K5 K8 Y12 R15 F16 Q17 P19 R23 G26 D29 Y31 R35 L36 K43 N45 L113 R140 P141 F142 F145 L146 I148 L150 R152 T153 H175 S176 N178 R179	K4 K7 Y11 R14 F15 Q16 P18 R22 G25 D28 Y30 R34 L35 K42 N44 L112 R139 P140 F141 F144 L145 I147 L149 R151 T152 H174 S175 N177 R178
BS02	rna	D5	A2 S10 S13 S14 F16 T18 F20 R21 R22 R24 T28 R33 R50 R54 T56 N57 K58 I61 Q63 I65 T70 D72 V74 Y79 H90 G91 N94 W95 Q151 R152 T155 G156 A157 R158 Y198 H203 Y207 E210 R218 L222 K224 F253 T256 K262 Y265 S269 Y272 Q274 T275 K276 L277 K279 R282 R285	A1 S9 S12 S13 F15 T17 F19 R20 R21 R23 T27 R32 R49 R53 T55 N56 K57 I60 Q62 I64 T69 D71 V73 Y78 H89 G90 N93 W94 Q150 R151 T154 G155 A156 R157 Y197 H202 Y206 E209 R217 L221 K223 F252 T255 K261 Y264 S268 Y271 Q273 T274 K275 L276 K278 R281 R284
BS03	MG	D5	N45 T46	N44 T45

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5m1j, PDBe:5m1j, PDBj:5m1j
PDBsum	5m1j
PubMed	27995908
UniProt	P26321\|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]