Structure of PDB 4v83 Chain D5

Receptor sequence
>4v83D5 (length=63) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
PKMKTHKGAKKRVKITASGKVVAMKTGKRHLNWQKSGKEIRQKGRKFVLA
KPEAERIKLLLPY
3D structure
PDB4v83 Crystal structures of complexes containing domains from two viral internal ribosome entry site (IRES) RNAs bound to the 70S ribosome.
ChainD5
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D5 P2 K3 M4 K5 T6 H7 K8 K12 R13 T17 A18 S19 K21 T27 G28 R30 H31 L32 N33 W34 K39 E40 R42 K44 R46 K47 L50 K52 E56 L62 P1 K2 M3 K4 T5 H6 K7 K11 R12 T16 A17 S18 K20 T26 G27 R29 H30 L31 N32 W33 K38 E39 R41 K43 R45 K46 L49 K51 E55 L61
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v83, PDBe:4v83, PDBj:4v83
PDBsum4v83
PubMed21245352
UniProtQ72L77|RL35_THET2 Large ribosomal subunit protein bL35 (Gene Name=rpmI)

[Back to BioLiP]