Structure of PDB 6gzz Chain D4

Receptor sequence

>6gzzD4 (length=208) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRP
SDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRL
DNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEK
SRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQ
LVIEFYSR

3D structure

PDB

6gzz Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.

Chain

Resolution

4.13 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D4	R3 I5 V8 R10 R14 K22 G23 E24 R25 K30 R35 R36 G41 Q42 H43 K46 Q62 S71 E72 R73 Q74 K84 K86 R115 Q119 R122 H123 H125 R132 V133 D134 L135 P136 S137 R139 K151 L155 E156 S208 R209	R2 I4 V7 R9 R13 K21 G22 E23 R24 K29 R34 R35 G40 Q41 H42 K45 Q61 S70 E71 R72 Q73 K83 K85 R114 Q118 R121 H122 H124 R131 V132 D133 L134 P135 S136 R138 K150 L154 E155 S207 R208

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation
GO:0042274	ribosomal small subunit biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6gzz, PDBe:6gzz, PDBj:6gzz
PDBsum	6gzz
PubMed	30301898
UniProt	P80373\|RS4_THET8 Small ribosomal subunit protein uS4 (Gene Name=rpsD)

[Back to BioLiP]