Structure of PDB 4w29 Chain D4

Receptor sequence
>4w29D4 (length=35) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEV
3D structure
PDB4w29 How the ribosome hands the A-site tRNA to the P site during EF-G-catalyzed translocation.
ChainD4
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D4 M1 K2 E3 H6 M1 K2 E3 H6
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4w29, PDBe:4w29, PDBj:4w29
PDBsum4w29
PubMed25190797
UniProtQ72JR0|RL31_THET2 Large ribosomal subunit protein bL31 (Gene Name=rpmE)

[Back to BioLiP]