Structure of PDB 4v9b Chain D4 |
>4v9bD4 (length=63) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] |
MKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFV DTEGRVERFQRRY |
|
PDB | 4v9b Structural basis for potent inhibitory activity of the antibiotic tigecycline during protein synthesis. |
Chain | D4 |
Resolution | 3.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
D4 |
M1 K2 H6 |
M1 K2 H6 |
|
|
|
|