Structure of PDB 4v6g Chain D3

Receptor sequence

>4v6gD3 (length=77) Species: 300852 (Thermus thermophilus HB8)

LGSTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRD
FTLFALVDGVVEFQDRGRLGRYVHVRP

3D structure

• PDB: 4v6g Structural aspects of messenger RNA reading frame maintenance by the ribosome.
• Chain: D3
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D3	R11 N12 R14 D15 S16 A18 K19 R20 K24 Y26 E27 Q29 R32 A33 G34 N35 I36 R39 R41 G42 T43 R44 G54 R55 D56 F57 F60 F69 R74 L75 R77	R5 N6 R8 D9 S10 A12 K13 R14 K18 Y20 E21 Q23 R26 A27 G28 N29 I30 R33 R35 G36 T37 R38 G48 R49 D50 F51 F54 F63 R68 L69 R71
BS02	rna	D3	R72 R74	R66 R68
BS03	MG	D3	L7 R11	L1 R5

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6g, PDBe:4v6g, PDBj:4v6g
• PDBsum: 4v6g
• PubMed: 20400952
• UniProt: P60493|RL27_THET8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)