Structure of PDB 4v4g Chain D3

Receptor sequence

>4v4gD3 (length=53) Species: 562 (Escherichia coli)

AKDGPRIIVKMESSAGTGFYYTTTKNRRNTQAKLELKKYDPVAKKHVVFR
EKK

3D structure

• PDB: 4v4g Structural basis for the control of translation initiation during stress.
• Chain: D3
• Resolution: 11.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D3	I8 I9 T25 K26 N27 R28 N30 T31 E36 K39 Y40 D41 K45 K46 H47	I7 I8 T24 K25 N26 R27 N29 T30 E35 K38 Y39 D40 K44 K45 H46

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 17:26:57 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v4g', asym_id = 'D3', title = 'Structural basis for the control of translation initiation during stress.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v4g', asym_id='D3', title='Structural basis for the control of translation initiation during stress.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v4g', asym_id = 'D3'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v4g', asym_id='D3')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>