Structure of PDB 7r81 Chain D2

Receptor sequence

>7r81D2 (length=210) Species: 5141 (Neurospora crassa) [Search protein sequence]

QPVTKLGRLVKAGKIKSMEEIYLHSLPIKEYQIVDFFLPKLKDEVMKIKP
VQKQTRAGQRTRFKAIVIIGDSEGHVGLGIKTSKEVATAIRAAIIIAKLS
VIPVRRGYWGANLGLPHSLPVKESGKCGSVTVRLIPAPRGTSLVASPAVK
RLLQLAGIEDAYTSSSGSTKTLENTLKATFAAVSNTYGFLTPNLWKETKL
TRSPLEEFAD

3D structure

PDB

7r81 Structure of the translating Neurospora ribosome arrested by cycloheximide

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D2	K94 V96 Q97 K98 Q99 T100 R101 A102 K109 S169 K171 C172 G173 S174 R178 I180 V189 Y207 T208 S210 S213 K215 T216 N219 K222	K49 V51 Q52 K53 Q54 T55 R56 A57 K64 S124 K126 C127 G128 S129 R133 I135 V144 Y162 T163 S165 S168 K170 T171 N174 K177
BS02	rna	D2	F108 V131 I135	F63 V86 I90

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0000054	ribosomal subunit export from nucleus
GO:0006412	translation
GO:0045903	positive regulation of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:0032040	small-subunit processome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7r81, PDBe:7r81, PDBj:7r81
PDBsum	7r81
PubMed	34815343
UniProt	Q7S503

[Back to BioLiP]