Structure of PDB 6c5l Chain D2

Receptor sequence
>6c5lD2 (length=71) Species: 274 (Thermus thermophilus) [Search protein sequence]
KLSEVRKQLEEARKLSPVELEKLVREKKRELMELRFQASIGQLSQNHKIR
DLKRQIARLLTVLNEKRRQNA
3D structure
PDB6c5l Conformation of methylated GGQ in the Peptidyl Transferase Center during Translation Termination.
ChainD2
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D2 K2 L3 R7 L10 R14 K29 Q46 N47 H48 R51 R55 A58 R59 L61 T62 N65 R69 K1 L2 R6 L9 R13 K28 Q45 N46 H47 R50 R54 A57 R58 L60 T61 N64 R68
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6c5l, PDBe:6c5l, PDBj:6c5l
PDBsum6c5l
PubMed29403017
UniProtQ5SHP6|RL29_THET8 Large ribosomal subunit protein uL29 (Gene Name=rpmC)

[Back to BioLiP]