Structure of PDB 5i4l Chain D2

Receptor sequence

>5i4lD2 (length=129) Species: 559292 (Saccharomyces cerevisiae S288C)

TRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFE
YIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGY
VILTTSAGIMDHEEARRKHVSGKILGFVY

3D structure

• PDB: 5i4l Amicoumacin A induces cancer cell death by targeting the eukaryotic ribosome.
• Chain: D2
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D2	T2 R3 S4 S5 V6 D9 N12 N16 R28 S31 K32 H56 R57 S58 K71 V74 I75 S76 N80 V81 K82 I83 W89 T105 T106 S107 K119 H120 S122 K124 Y130	T1 R2 S3 S4 V5 D8 N11 N15 R27 S30 K31 H55 R56 S57 K70 V73 I74 S75 N79 V80 K81 I82 W88 T104 T105 S106 K118 H119 S121 K123 Y129

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5i4l, PDBe:5i4l, PDBj:5i4l
• PDBsum: 5i4l
• PubMed: 27296282
• UniProt: P0C0W1|RS22A_YEAST Small ribosomal subunit protein uS8A (Gene Name=RPS22A)