Structure of PDB 4v9m Chain D2

Receptor sequence
>4v9mD2 (length=71) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
KLSEVRKQLEEARKLSPVELEKLVREKKRELMELRFQASIGQLSQNHKIR
DLKRQIARLLTVLNEKRRQNA
3D structure
PDB4v9m Crystal structures of EF-G-ribosome complexes trapped in intermediate states of translocation.
ChainD2
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D2 R7 L10 K29 N47 H48 R51 K54 R55 A58 R59 L61 N65 R6 L9 K28 N46 H47 R50 K53 R54 A57 R58 L60 N64
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v9m, PDBe:4v9m, PDBj:4v9m
PDBsum4v9m
PubMed23812722
UniProtQ72I12|RL29_THET2 Large ribosomal subunit protein uL29 (Gene Name=rpmC)

[Back to BioLiP]