Structure of PDB 4v63 Chain D2

Receptor sequence
>4v63D2 (length=72) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
MKLSEVRKQLEEARKLSPVELEKLVREKKRELMELRFQASIGQLSQNHKI
RDLKRQIARLLTVLNEKRRQNA
3D structure
PDB4v63 Structural basis for translation termination on the 70S ribosome
ChainD2
Resolution3.207 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D2 M1 K2 L3 R7 N47 H48 I50 R51 K54 R55 A58 R59 T62 E66 M1 K2 L3 R7 N47 H48 I50 R51 K54 R55 A58 R59 T62 E66
BS02 MG D2 L64 N65 E66 K67 R68 R69 L64 N65 E66 K67 R68 R69
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v63, PDBe:4v63, PDBj:4v63
PDBsum4v63
PubMed18596689
UniProtQ72I12|RL29_THET2 Large ribosomal subunit protein uL29 (Gene Name=rpmC)

[Back to BioLiP]