Structure of PDB 4w29 Chain D1

Receptor sequence

>4w29D1 (length=93) Species: 300852 (Thermus thermophilus HB8)

KVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVR
VAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELL

3D structure

• PDB: 4w29 How the ribosome hands the A-site tRNA to the P site during EF-G-catalyzed translocation.
• Chain: D1
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D1	G28 K32 K33	G26 K30 K31
BS02	rna	D1	K3 K10 R11 P12 V14 I18 Q19 R20 R21 K25 R26 V30 T34 T35 I37 R40 Q42 Y43 P44 N45 Q47 V49 R50 R52 R61 A64 S65 H66 K69 R76 L80 K81 K88	K1 K8 R9 P10 V12 I16 Q17 R18 R19 K23 R24 V28 T32 T33 I35 R38 Q40 Y41 P42 N43 Q45 V47 R48 R50 R59 A62 S63 H64 K67 R74 L78 K79 K86

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4w29, PDBe:4w29, PDBj:4w29
• PDBsum: 4w29
• PubMed: 25190797
• UniProt: P60494|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)