Structure of PDB 4v8x Chain D1

Receptor sequence

>4v8xD1 (length=93) Species: 300852 (Thermus thermophilus HB8)

KVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVR
VAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELL

3D structure

• PDB: 4v8x Yoeb-Ribosome Structure: A Canonical Rnase that Requires the Ribosome for its Specific Activity.
• Chain: D1
• Resolution: 3.35 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D1	K3 K10 I13 A15 N16 Q19 R20 R21 K25 G29 V30 K33 T34 T35 K39 R40 R41 Q42 Y43 P44 N45 Q47 K48 R50 R52 R61 A64 S65 H66 K69 R76 G79 L80 K81 E89	K1 K8 I11 A13 N14 Q17 R18 R19 K23 G27 V28 K31 T32 T33 K37 R38 R39 Q40 Y41 P42 N43 Q45 K46 R48 R50 R59 A62 S63 H64 K67 R74 G77 L78 K79 E87

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v8x, PDBe:4v8x, PDBj:4v8x
• PDBsum: 4v8x
• PubMed: 23945936
• UniProt: P60494|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)