Structure of PDB 4v8i Chain D1

Receptor sequence

>4v8iD1 (length=97) Species: 274 (Thermus thermophilus) [Search protein sequence]

SKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRV
RVAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELLKLL

3D structure

PDB

4v8i How hibernation factors RMF, HPF, and YfiA turn off protein synthesis.

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D1	S2 K3 K10 R11 I13 V14 A15 N16 Q19 R20 R21 A24 K25 G28 G29 V30 G31 K32 K33 T34 T35 I37 K39 R40 R41 Q42 Y43 P44 N45 Q47 K48 R50 G55 R61 H66 K69 R76 L80	S1 K2 K9 R10 I12 V13 A14 N15 Q18 R19 R20 A23 K24 G27 G28 V29 G30 K31 K32 T33 T34 I36 K38 R39 R40 Q41 Y42 P43 N44 Q46 K47 R49 G54 R60 H65 K68 R75 L79

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v8i, PDBe:4v8i, PDBj:4v8i
PDBsum	4v8i
PubMed	22605777
UniProt	P60494\|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)