Structure of PDB 4v9n Chain D0

Receptor sequence

>4v9nD0 (length=76) Species: 262724 (Thermus thermophilus HB27)

TKNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDFTL
FALVDGVVEFQDRGRLGRYVHVRPLA

3D structure

• PDB: 4v9n Crystal Structure of the 70S Ribosome Bound with the Q253P Mutant Form of Release Factor RF2.
• Chain: D0
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D0	N12 R14 D15 S16 Q17 A18 K19 R20 V23 K24 Y26 E27 Q29 R32 A33 G34 N35 I36 R39 R41 G42 T43 R44 G54 R55 D56 F57 F60 F69 R77	N3 R5 D6 S7 Q8 A9 K10 R11 V14 K15 Y17 E18 Q20 R23 A24 G25 N26 I27 R30 R32 G33 T34 R35 G45 R46 D47 F48 F51 F60 R68
BS02	rna	D0	R72 G73 R74	R63 G64 R65
BS03	MG	D0	G42 F57	G33 F48

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:4v9n, PDBe:4v9n, PDBj:4v9n
• PDBsum: 4v9n
• PubMed: 23769667
• UniProt: Q72HR3|RL27_THET2 Large ribosomal subunit protein bL27 (Gene Name=rpmA)