Structure of PDB 4v9k Chain D0

Receptor sequence

>4v9kD0 (length=84) Species: 262724 (Thermus thermophilus HB27)

AHKKGLGSTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNV
GMGRDFTLFALVDGVVEFQDRGRLGRYVHVRPLA

3D structure

• PDB: 4v9k Crystal structures of EF-G-ribosome complexes trapped in intermediate states of translocation.
• Chain: D0
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D0	A2 K4 T10 R11 N12 R14 D15 S16 K19 R20 V23 K24 R25 Y26 E27 Q29 R32 A33 G34 N35 R39 R41 G42 T43 R44 F45 G54 R55 D56 F57 F60 F69 L75 R77	A1 K3 T9 R10 N11 R13 D14 S15 K18 R19 V22 K23 R24 Y25 E26 Q28 R31 A32 G33 N34 R38 R40 G41 T42 R43 F44 G53 R54 D55 F56 F59 F68 L74 R76
BS02	rna	D0	R72 G73	R71 G72

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v9k, PDBe:4v9k, PDBj:4v9k
• PDBsum: 4v9k
• PubMed: 23812722
• UniProt: Q72HR3|RL27_THET2 Large ribosomal subunit protein bL27 (Gene Name=rpmA)