Structure of PDB 4v8i Chain D0

Receptor sequence

>4v8iD0 (length=77) Species: 274 (Thermus thermophilus)

STRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDFT
LFALVDGVVEFQDRGRLGRYVHVRPLA

3D structure

• PDB: 4v8i How hibernation factors RMF, HPF, and YfiA turn off protein synthesis.
• Chain: D0
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D0	T10 N12 R14 D15 S16 Q17 A18 K19 R20 K24 Y26 E27 Q29 A33 G34 N35 I36 R39 R41 G42 T43 R44 G54 R55 D56 F57 F60 F69 R74 L75 R77	T2 N4 R6 D7 S8 Q9 A10 K11 R12 K16 Y18 E19 Q21 A25 G26 N27 I28 R31 R33 G34 T35 R36 G46 R47 D48 F49 F52 F61 R66 L67 R69
BS02	rna	D0	R72 R74	R64 R66

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v8i, PDBe:4v8i, PDBj:4v8i
• PDBsum: 4v8i
• PubMed: 22605777
• UniProt: P60493|RL27_THET8 Large ribosomal subunit protein bL27 (Gene Name=rpmA)