Structure of PDB 9fgq Chain D

Receptor sequence
>9fgqD (length=93) Species: 9606 (Homo sapiens) [Search protein sequence]
RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAH
YNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
3D structure
PDB9fgq Spatial control of the APC/C ensures the rapid degradation of Cyclin B1
ChainD
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide D Q44 V45 Q15 V16
BS02 dna D Y39 S53 S84 T85 Y10 S24 S55 T56
BS03 dna D R30 Y37 R1 Y8
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:9fgq, PDBe:9fgq, PDBj:9fgq
PDBsum9fgq
PubMed39143240
UniProtP33778|H2B1B_HUMAN Histone H2B type 1-B (Gene Name=H2BC3)

[Back to BioLiP]