Structure of PDB 8wtb Chain D

Receptor sequence

>8wtbD (length=99) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

ISACPKCGMTFQQFRKIGRFGCSECYKTFHSNITPILRKVHSGNTVHAGK
IPKRIGGNLHVRRQIDMLKKELESLIHQEEFENAAHVRDQIRLLEQSLK

3D structure

• PDB: 8wtb Structural insights into the regulation of protein-arginine kinase McsB by McsA.
• Chain: D
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	D	C81 C84	C4 C7

Gene Ontology

Molecular Function

• GO:0005507 copper ion binding
• GO:0008270 zinc ion binding
• GO:0046870 cadmium ion binding
• GO:0050897 cobalt ion binding

Biological Process

• GO:0006508 proteolysis
• GO:1990169 stress response to copper ion
• GO:1990170 stress response to cadmium ion

External links

• PDB: RCSB:8wtb, PDBe:8wtb, PDBj:8wtb
• PDBsum: 8wtb
• PubMed: 38625935
• UniProt: P37569|MCSA_BACSU Protein-arginine kinase activator protein (Gene Name=mcsA)