Structure of PDB 8wie Chain D |
>8wieD (length=189) Species: 9606 (Homo sapiens) [Search protein sequence] |
NTLQKIINKPLSDFLKGTSQVRQNYHRDSEAAINKQITLELYASYVYLSM SYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIQK PDCDDWESGLNAMECALHLEKEVNQELLNLHKLATDKNDPHLCDFIETHY LNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLG |
|
PDB | 8wie Unlocking Immunogenic Potential: Innovating a Peptide/Ferritin Fusion Tag Nano-Delivery Platform from de novo design to Significantly Enhance Antigenicity of the Rabies Virus Glycoprotein Domain III |
Chain | D |
Resolution | 2.3 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
D |
E28 E63 H66 Q142 |
E40 E75 H78 Q154 |
|
|
|