Structure of PDB 8wh9 Chain D |
>8wh9D (length=89) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] |
TYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLASESSKLARYNK KPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS |
|
PDB | 8wh9 Molecular basis of chromatin remodelling by DDM1 involved in plant DNA methylation. |
Chain | D |
Resolution | 3.31 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
D |
T61 Y65 |
T1 Y5 |
|
BS02 |
dna |
D |
S81 P112 |
S21 P52 |
|
|
|
|