Structure of PDB 8w6j Chain D

Receptor sequence
>8w6jD (length=217) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MIRFEHVSKAYLGGRQALQGVTFHMQPGEMAFLTGHSGAGKSTLLKLICG
IERPSAGKIWFSGHDITRLKNREVPFLRRQIGMIFQDHHLLMDRTVYDNV
AIPLIIAGASGDDIRRRVSAALDKVGLLDKAKNFPIQLSGGEQQRVGIAR
AVVNKPAVLLADQPTGNLDDALSEGILRLFEEFNRVGVTVLMATHDINLI
SRRSYRMLTLSDGHLHG
3D structure
PDB8w6j Cryo-EM structure of Escherichia coli Str K12 FtsE(E163Q)X/EnvC complex with ATP in peptidisc
ChainD
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP D Q137 S139 G141 E142 Q137 S139 G141 E142
BS02 ATP D Y11 S37 G38 A39 G40 K41 S42 T43 Q86 H195 Y11 S37 G38 A39 G40 K41 S42 T43 Q86 H195
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016887 ATP hydrolysis activity
GO:0022857 transmembrane transporter activity
Biological Process
GO:0000917 division septum assembly
GO:0009254 peptidoglycan turnover
GO:0043093 FtsZ-dependent cytokinesis
GO:0046677 response to antibiotic
GO:0051301 cell division
GO:0051781 positive regulation of cell division
GO:0055085 transmembrane transport
Cellular Component
GO:0000935 division septum
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0019898 extrinsic component of membrane
GO:0032153 cell division site
GO:0098797 plasma membrane protein complex
GO:1904949 ATPase complex
GO:1990586 divisome complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8w6j, PDBe:8w6j, PDBj:8w6j
PDBsum8w6j
PubMed
UniProtP0A9R7|FTSE_ECOLI Cell division ATP-binding protein FtsE (Gene Name=ftsE)

[Back to BioLiP]