Structure of PDB 8w2r Chain D

Receptor sequence
>8w2rD (length=47) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence]
NFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKII
3D structure
PDB8w2r HIV-1 integrase assembles multiple species of stable synaptic complex intasomes that are active for concerted DNA integration in vitro.
ChainD
Resolution3.23 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D W243 E246 G247 A248 V250 R263 W22 E25 G26 A27 V29 R42
BS02 dna D R228 R263 R7 R42
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0008270 zinc ion binding
Biological Process
GO:0015074 DNA integration

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8w2r, PDBe:8w2r, PDBj:8w2r
PDBsum8w2r
PubMed38582148
UniProtP12497|POL_HV1N5 Gag-Pol polyprotein (Gene Name=gag-pol)

[Back to BioLiP]