Structure of PDB 8vxu Chain D |
>8vxuD (length=104) Species: 2044939 (Clostridia bacterium) [Search protein sequence] |
MAWLILIIAGIFEVVWAIALKYSNGFTRLIPSMITLIGMLISFYLLSQAT KTLPIGTAYTIWTGIGALGAVICGIIFFKEPLTALRIVFMILLLTGIIGL KATS |
|
PDB | 8vxu Peripheral mutations underlie promiscuous transport of quaternary ammonium antiseptics by Small Multidrug Resistance transporters |
Chain | D |
Resolution | 2.29 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
16A |
D |
E13 W16 T63 |
E13 W16 T63 |
|
|
|
|