Structure of PDB 8vjn Chain D |
>8vjnD (length=52) Species: 34 (Myxococcus xanthus) [Search protein sequence] |
SAFDRDFGYLMPFLDRVAAAASDLEDASARAELTRLMVEEKARWQRIQEL LG |
|
PDB | 8vjn Myxococcus xanthus encapsulin cargo protein EncD is a flavin-binding protein with ferric reductase activity |
Chain | D |
Resolution | 2.31 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FMN |
D |
R12 D13 Y16 |
R5 D6 Y9 |
|
|
|