Structure of PDB 8vj7 Chain D

Receptor sequence
>8vj7D (length=795) Species: 10116 (Rattus norvegicus) [Search protein sequence]
NSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVT
NAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDGTHPF
VIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQ
VTAINVGNINNDKKDETYRSLFQDLELKKERRVILDCERDKVNDIVDQVI
TIGKHVKGYHYIIANLGFTDGDLLKIQFGGAEVSGFQIVDYDDSLVSKFI
ERWSTLEEKEYPGAHTATIKYTSALTYDAVQVMTEAFRNLRKQRIEISRR
GNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTIN
IMELKTNGPRKIGYWSEVDKMVLTEDDTSGLEQKTVVVTTILESPYVMMK
KNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI
WNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQK
SKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYSESTNEFGIF
NSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFL
TVERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYM
RSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVG
GNLDSKGYGIATPKGSSLGTPVNLAVLKLSEQGVLDKLKNKWWYDKGECG
AKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR
3D structure
PDB8vj7 Allosteric Competition and Inhibition in AMPA Receptors.
ChainD
Resolution4.85 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 GLU D Y450 P478 T480 R485 S654 E705 Y732 Y441 P469 T471 R476 S630 E681 Y708
BS02 A1AB5 D S516 F517 D519 L620 F623 N791 S507 F508 D510 L596 F599 N767
Gene Ontology
Molecular Function
GO:0000149 SNARE binding
GO:0001540 amyloid-beta binding
GO:0004970 glutamate-gated receptor activity
GO:0004971 AMPA glutamate receptor activity
GO:0005230 extracellular ligand-gated monoatomic ion channel activity
GO:0005234 extracellularly glutamate-gated ion channel activity
GO:0005515 protein binding
GO:0008092 cytoskeletal protein binding
GO:0015277 kainate selective glutamate receptor activity
GO:0019865 immunoglobulin binding
GO:0019901 protein kinase binding
GO:0022849 glutamate-gated calcium ion channel activity
GO:0030165 PDZ domain binding
GO:0035254 glutamate receptor binding
GO:0035255 ionotropic glutamate receptor binding
GO:0038023 signaling receptor activity
GO:0042802 identical protein binding
GO:0044877 protein-containing complex binding
GO:0097110 scaffold protein binding
GO:0099094 ligand-gated monoatomic cation channel activity
GO:0099507 ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential
GO:1904315 transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential
Biological Process
GO:0001919 regulation of receptor recycling
GO:0007268 chemical synaptic transmission
GO:0010226 response to lithium ion
GO:0019722 calcium-mediated signaling
GO:0021987 cerebral cortex development
GO:0031623 receptor internalization
GO:0034220 monoatomic ion transmembrane transport
GO:0035235 ionotropic glutamate receptor signaling pathway
GO:0035249 synaptic transmission, glutamatergic
GO:0045184 establishment of protein localization
GO:0050804 modulation of chemical synaptic transmission
GO:0050806 positive regulation of synaptic transmission
GO:0051262 protein tetramerization
GO:0051966 regulation of synaptic transmission, glutamatergic
GO:0060078 regulation of postsynaptic membrane potential
GO:0060079 excitatory postsynaptic potential
GO:0060992 response to fungicide
GO:0098655 monoatomic cation transmembrane transport
GO:0099505 regulation of presynaptic membrane potential
GO:1905430 cellular response to glycine
GO:1990416 cellular response to brain-derived neurotrophic factor stimulus
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0005886 plasma membrane
GO:0008021 synaptic vesicle
GO:0008328 ionotropic glutamate receptor complex
GO:0009986 cell surface
GO:0014069 postsynaptic density
GO:0016020 membrane
GO:0030424 axon
GO:0030425 dendrite
GO:0030426 growth cone
GO:0030672 synaptic vesicle membrane
GO:0032279 asymmetric synapse
GO:0032281 AMPA glutamate receptor complex
GO:0032590 dendrite membrane
GO:0032839 dendrite cytoplasm
GO:0032991 protein-containing complex
GO:0036477 somatodendritic compartment
GO:0042734 presynaptic membrane
GO:0043005 neuron projection
GO:0043025 neuronal cell body
GO:0043195 terminal bouton
GO:0043197 dendritic spine
GO:0043198 dendritic shaft
GO:0043204 perikaryon
GO:0044326 dendritic spine neck
GO:0044327 dendritic spine head
GO:0045202 synapse
GO:0045211 postsynaptic membrane
GO:0048787 presynaptic active zone membrane
GO:0097060 synaptic membrane
GO:0098685 Schaffer collateral - CA1 synapse
GO:0098793 presynapse
GO:0098839 postsynaptic density membrane
GO:0098978 glutamatergic synapse
GO:0099544 perisynaptic space
GO:0106033 spine synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8vj7, PDBe:8vj7, PDBj:8vj7
PDBsum8vj7
PubMed38834914
UniProtP19491|GRIA2_RAT Glutamate receptor 2 (Gene Name=Gria2)

[Back to BioLiP]