Structure of PDB 8uzt Chain D |
>8uztD (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] |
TSLVLERSLNRVHLLGRVGQDPVLRNPVTIFSLATNEMWRDVSQKTTWHR ISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADN IIFLSDQ |
|
PDB | 8uzt Structures of the mitochondrial single-stranded DNA binding protein with DNA and DNA polymerase gamma. |
Chain | D |
Resolution | 1.9 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
D |
R28 N124 |
R7 N88 |
|
|
|