Structure of PDB 8uua Chain D

Receptor sequence

>8uuaD (length=206) Species: 1642 (Listeria innocua) [Search protein sequence]

TKGILGRKVGMTQVFTENGELIPVTVIEAAQNVVLQKKTVETDGYEAVQI
GFEDKRAKLSNKPEQGHVAKADTTPKRFIREFRDVNLDEYEIGAEVKVDV
FAEGDIIDATGVSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAP
NRVFKNKLLPGRMGGEQITIQNLEIVKVDVEKNVLLVKGNVPGAKKALVQ
IKTATK

3D structure

PDB

8uua Mechanistic insights into the alternative ribosome recycling by HflXr.

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	M12 Q14 P24 D44 Y46 R57 K59 N62 K63 P64 G67 H68 K71 R78 E82 R84 S114 K115 G116 K117 F119 G121 K124 R125 Q128 S129 R130 M133 H135 G136 R138 Y139 H140 R141 R142 G144 S145 M146 G147 P148 V149 A150 P151 N152 R153 V154 F155 K158 L160 R163 Q168 I169 T170 Q172 N173 G194 K207	M11 Q13 P23 D43 Y45 R56 K58 N61 K62 P63 G66 H67 K70 R77 E81 R83 S113 K114 G115 K116 F118 G120 K123 R124 Q127 S128 R129 M132 H134 G135 R137 Y138 H139 R140 R141 G143 S144 M145 G146 P147 V148 A149 P150 N151 R152 V153 F154 K157 L159 R162 Q167 I168 T169 Q171 N172 G193 K206
BS02	MG	D	Y139 G144	Y138 G143

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8uua, PDBe:8uua, PDBj:8uua
PDBsum	8uua
PubMed	38407413
UniProt	A0A0U5ADD0

[Back to BioLiP]