Structure of PDB 8thx Chain D

Receptor sequence

>8thxD (length=370) Species: 4930 (Saccharomyces)

AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVG
DEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLL
TEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDS
GDGVTHVVPIYEGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAE
REIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERF
RAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTM
FPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQM
WISKQEYDESGPSIVHHKCF

3D structure

• PDB: 8thx yeast actin A167E mutant wt-like
• Chain: D
• Resolution: 3.98 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	D	G13 G15 M16 K18 D157 K213 E214 G301 G302 F306 K336	G8 G10 M11 K13 D152 K208 E209 G296 G297 F301 K331

Gene Ontology

Molecular Function

• GO:0005200 structural constituent of cytoskeleton
• GO:0005524 ATP binding
• GO:0016787 hydrolase activity
• GO:0016887 ATP hydrolysis activity
• GO:0042802 identical protein binding

Biological Process

• GO:0000011 vacuole inheritance
• GO:0006281 DNA repair
• GO:0006338 chromatin remodeling
• GO:0006897 endocytosis
• GO:0009306 protein secretion
• GO:0030010 establishment of cell polarity
• GO:0030476 ascospore wall assembly
• GO:1902404 mitotic actomyosin contractile ring contraction

Cellular Component

• GO:0000142 cellular bud neck contractile ring
• GO:0000785 chromatin
• GO:0000812 Swr1 complex
• GO:0005576 extracellular region
• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005856 cytoskeleton
• GO:0005884 actin filament
• GO:0030479 actin cortical patch
• GO:0031011 Ino80 complex
• GO:0032432 actin filament bundle
• GO:0035267 NuA4 histone acetyltransferase complex
• GO:0062040 fungal biofilm matrix

External links

• PDB: RCSB:8thx, PDBe:8thx, PDBj:8thx
• PDBsum: 8thx
• UniProt: P60009|ACT_CANGA Actin (Gene Name=ACT1)