Structure of PDB 8tgy Chain D |
>8tgyD (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] |
SVPTKLEVVAATPTSLLISWDAGHWWEWVTYYRITYGETGGNSPVQEFTV PGYSSTATISGLKPGVDYTITVYAPTSDSPISINYRT |
|
PDB | 8tgy Transport of metformin metabolites by guanidinium exporters of the Small Multidrug Resistance family. |
Chain | D |
Resolution | 2.18 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
DMU |
D |
Y34 R36 E50 T52 |
Y31 R33 E47 T49 |
|
|
|