Structure of PDB 8srx Chain D |
>8srxD (length=75) Species: 9606 (Homo sapiens) [Search protein sequence] |
ASTKKLSESLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDG NFNWGRVVALFYFASKLVLKALSTK |
|
PDB | 8srx Sequence differences between BAX and BAK core domains manifest as differences in their interactions with lipids. |
Chain | D |
Resolution | 2.09 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
K6G |
D |
F100 G103 L113 F114 |
F47 G50 L60 F61 |
|
|
|
|