Structure of PDB 8spe Chain D |
>8speD (length=71) Species: 9606 (Homo sapiens) [Search protein sequence] |
STKKLSESLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGN FNWGRVVALFYFASKLVLKAL |
|
PDB | 8spe Sequence differences between BAX and BAK core domains manifest as differences in their interactions with lipids. |
Chain | D |
Resolution | 2.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
D |
D84 D86 |
D30 D32 |
|
|
|
|