Structure of PDB 8siy Chain D

Receptor sequence
>8siyD (length=79) Species: 8355 (Xenopus laevis) [Search protein sequence]
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYT
EHAKRKTVTAMDVVYALKRQGRTLYGFGG
3D structure
PDB8siy A dual role for the chromatin reader ORCA/LRWD1 in targeting the origin recognition complex to chromatin.
ChainD
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D T30 P32 R36 T7 P9 R13
BS02 dna D R35 R45 I46 G48 K79 T80 R12 R22 I23 G25 K56 T57
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8siy, PDBe:8siy, PDBj:8siy
PDBsum8siy
PubMed37551430
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]