Structure of PDB 8rd8 Chain D

Receptor sequence
>8rd8D (length=105) Species: 45610 (Psychrobacter urativorans) [Search protein sequence]
MNVTIRGHHITVTEAMNNAVHDKLTKIARHFDQIQSIQVILSLDNSGASD
GGQKSHKAEAIMRVSGQEMFVQALEDDMYKAINEMADKLDRQVSKYKTRL
ERNKV
3D structure
PDB8rd8 A new family of bacterial ribosome hibernation factors
ChainD
Resolution2.62 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D R6 H8 H9 K26 H30 Q35 I40 N45 S46 A48 S49 D50 G51 Q53 E59 I61 G66 Q67 F70 Q72 Y79 K80 K88 R91 K95 K97 T98 R99 E101 R102 V105 R6 H8 H9 K26 H30 Q35 I40 N45 S46 A48 S49 D50 G51 Q53 E59 I61 G66 Q67 F70 Q72 Y79 K80 K88 R91 K95 K97 T98 R99 E101 R102 V105
Gene Ontology
Molecular Function
GO:0043024 ribosomal small subunit binding
Biological Process
GO:0006417 regulation of translation
GO:0044238 primary metabolic process
GO:0045900 negative regulation of translational elongation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rd8, PDBe:8rd8, PDBj:8rd8
PDBsum8rd8
PubMed38355796
UniProtA0A0M4TFB0

[Back to BioLiP]