Structure of PDB 8r67 Chain D

Receptor sequence

>8r67D (length=426) Species: 9913 (Bos taurus)

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVY
YNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNN
WAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTL
LISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETY
CIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADL
RKLAVNMVPFPRLHFFMPGFAPLTSRGSLTVPELTQQMFDSKNMMAACDP
RHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCD
IPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDE
MEFTEAESNMNDLVSEYQQYQDATAD

3D structure

• PDB: 8r67 Bridging the maytansine and vinca sites: cryptophycins target beta-tubulin's T5-loop.
• Chain: D
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GDP	D	Q11 C12 S140 G143 G144 T145 S178 E183 N206 Y224 N228	Q11 C12 S138 G141 G142 T143 S176 E181 N204 Y222 N226
BS02	Y74	D	P173 S174 P175 V177 S178 D179 T180 E183 P184 Q394	P171 S172 P173 V175 S176 D177 T178 E181 P182 Q379
BS03	Y74	D	A99 G100 N101 K105 V181 V182 F404 W407	A97 G98 N99 K103 V179 V180 F389 W392

Gene Ontology

Molecular Function

• GO:0005200 structural constituent of cytoskeleton
• GO:0005525 GTP binding
• GO:0046872 metal ion binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0000226 microtubule cytoskeleton organization
• GO:0000278 mitotic cell cycle
• GO:0007017 microtubule-based process
• GO:0007399 nervous system development
• GO:1902669 positive regulation of axon guidance

Cellular Component

• GO:0005737 cytoplasm
• GO:0005856 cytoskeleton
• GO:0005874 microtubule
• GO:0015630 microtubule cytoskeleton

External links

• PDB: RCSB:8r67, PDBe:8r67, PDBj:8r67
• PDBsum: 8r67
• PubMed: 38735475
• UniProt: Q6B856|TBB2B_BOVIN Tubulin beta-2B chain (Gene Name=TUBB2B)