Structure of PDB 8r0a Chain D

Receptor sequence
>8r0aD (length=141) Species: 9606 (Homo sapiens) [Search protein sequence]
SYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEK
VKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNK
INWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY
3D structure
PDB8r0a Structural insights into the cross-exon to cross-intron spliceosome switch
ChainD
Resolution5.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D T138 K139 T137 K138
BS02 rna D G95 R127 G128 G94 R126 G127
BS03 rna D R124 K125 G126 R123 K124 G125
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000375 RNA splicing, via transesterification reactions
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0051301 cell division
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005682 U5 snRNP
GO:0005829 cytosol
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8r0a, PDBe:8r0a, PDBj:8r0a
PDBsum8r0a
PubMed38778104
UniProtP83876|TXN4A_HUMAN Thioredoxin-like protein 4A (Gene Name=TXNL4A)

[Back to BioLiP]