Structure of PDB 8qu5 Chain D

Receptor sequence

>8qu5D (length=220) Species: 9606 (Homo sapiens)

ANFVSWKSRTKYTITPVKMRKSGGRDHTGRIRVHGIGGGHKQRYRMIDFL
RFRPEETKSGPFEEKVIQVRYDPCRSADIALVAGGSRKRWIIATENMQAG
DTILNSNHIGRMAVAAREGDAHPLGALPVGTLINNVESEPGRGAQYIRAA
GTCGVLLRKVNGTAIIQLPSKRQMQVLETCVATVGRVSNVDHNKRVIGKA
GRNRWLGKRPNSLPPMKSYV

3D structure

• PDB: 8qu5 GTPBP8 plays a role in mitoribosome formation in human mitochondria.
• Chain: D
• Resolution: 2.42 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	W66 K67 R69 K71 T75 S82 G84 H87 R92 V93 H100 K101 Q102 R103 Y104 R105 I127 Q128 R130 Y131 P133 R135 L141 K148 W150 R202 Q205 Y206 I207 R208 A209 A210 G211 L228 P229 S230 R232 R246 H252 N253 I257 G258 R262 N263 W265 L266 P270 N271 S272 K293 Y295	W6 K7 R9 K11 T15 S22 G24 H27 R32 V33 H40 K41 Q42 R43 Y44 R45 I67 Q68 R70 Y71 P73 R75 L81 K88 W90 R142 Q145 Y146 I147 R148 A149 A150 G151 L168 P169 S170 R172 R186 H192 N193 I197 G198 R202 N203 W205 L206 P210 N211 S212 K217 Y219

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005654 nucleoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8qu5, PDBe:8qu5, PDBj:8qu5
• PDBsum: 8qu5
• PubMed: 38969660
• UniProt: Q5T653|RM02_HUMAN Large ribosomal subunit protein uL2m (Gene Name=MRPL2)