Structure of PDB 8qrn Chain D

Receptor sequence

>8qrnD (length=343) Species: 9606 (Homo sapiens)

SFFTKLTADELWKGALAETGAGAKKGRGKRTKKKKRKDLNRGQIIGEGRY
GFLWPGLNVPLMKNGAVQTIAQRSKEEQEKVEADMIQQREEWDRKKKMKV
KRERGWSGNSWGGISLGPPDPGPCGETYEDFDTRILEVRNVFTMTAKEGR
KKSIRVLVAVGNGKGAAGFSIGKATDRMDAFRKAKNRAVHHLHYIERYED
HTIFHDISLRFKRTHIKMKKQPKGYGLRCHRAIITICRLIGIKDMYAKVS
GSINMLSLTQGLFRGLSRQETHQQLADKKGLHVVEIREECGPLPIVVASP
RGPLRKDPEPEDEVPDVKLDWEDVKTAQGMKRSVWSNLKRAAT

3D structure

• PDB: 8qrn GTPBP8 plays a role in mitoribosome formation in human mitochondria.
• Chain: D
• Resolution: 2.98 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	T91 K100 G101 A104 T106 G109 K111 K112 R114 T118 K119 R191 S194 G195 N196 R226 T230 M231 A233 K234 E235 F256 K260 R269 K270 R274 R297 F298 K299 R300 R315 C316 H317 R318 A334 K335 S339 I340 L343 Q347 W408 K418 R419 S420 V421 W422 S423 R427	T4 K13 G14 A17 T19 G22 K24 K25 R27 T31 K32 R104 S107 G108 N109 R139 T143 M144 A146 K147 E148 F169 K173 R182 K183 R187 R210 F211 K212 R213 R228 C229 H230 R231 A247 K248 S252 I253 L256 Q260 W321 K331 R332 S333 V334 W335 S336 R340

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8qrn, PDBe:8qrn, PDBj:8qrn
• PDBsum: 8qrn
• PubMed: 38969660
• UniProt: P82675|RT05_HUMAN Small ribosomal subunit protein uS5m (Gene Name=MRPS5)