Structure of PDB 8qrm Chain D

Receptor sequence

>8qrmD (length=340) Species: 9606 (Homo sapiens)

SFFTKLTADELWKGALAETGAGAKKGRGKRTKKKKRKDLNRGQIIGEGRY
GFLWPGLNVPLMKNGAVQTIAQRSKEEQEKVEADMIQQREEWDRKKKKRE
RGWSGNSWGGISLGPPDPGPCGETYEDFDTRILEVRNVFTMTAKEGRKKS
IRVLVAVGNGKGAAGFSIGKATDRMDAFRKAKNRAVHHLHYIERYEDHTI
FHDISLRFKRTHIKMKKQPKGYGLRCHRAIITICRLIGIKDMYAKVSGSI
NMLSLTQGLFRGLSRQETHQQLADKKGLHVVEIREECGPLPIVVASPRGP
LRKDPEPEDEVPDVKLDWEDVKTAQGMKRSVWSNLKRAAT

3D structure

• PDB: 8qrm GTPBP8 plays a role in mitoribosome formation in human mitochondria.
• Chain: D
• Resolution: 3.05 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	T91 K100 G101 A104 T106 G109 K111 K112 R114 R191 S194 G195 N196 R226 T230 M231 A233 K234 E235 F256 K260 R269 K270 R274 R297 F298 K299 R300 R315 C316 H317 R318 A334 K335 S339 I340 L343 Q347 W408 K418 R419 S420 V421 W422 S423 R427	T4 K13 G14 A17 T19 G22 K24 K25 R27 R101 S104 G105 N106 R136 T140 M141 A143 K144 E145 F166 K170 R179 K180 R184 R207 F208 K209 R210 R225 C226 H227 R228 A244 K245 S249 I250 L253 Q257 W318 K328 R329 S330 V331 W332 S333 R337

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8qrm, PDBe:8qrm, PDBj:8qrm
• PDBsum: 8qrm
• PubMed: 38969660
• UniProt: P82675|RT05_HUMAN Small ribosomal subunit protein uS5m (Gene Name=MRPS5)