Structure of PDB 8qg1 Chain D

Receptor sequence

>8qg1D (length=418) Species: 224324 (Aquifex aeolicus VF5)

RSYPAIPRIYAETTLNMLLKRAKKPRVHSIDEYLKDGGYQALEKALNMSP
EEIIDWVDKSTLRGRGGAGFPTGKKWKFAVQNPGPRYFICNADESEPGTF
KDRIIIERDPHLLIEGIIISSYAIGANEAYIYIRGEYPAGYYILRDAIEE
AKKKGFLGKNILGSGFDLEIYVARGAGAYICGEETALIESLEGKRGHPRL
KPPYPVQKGLWGKPTVVNNVETIANVPFIISMGWEEYRYIGPSDYAGPKL
FPVSGKVKKPGVYELPMNTTLREVIFKYAGGTLGNKKVKAVFSGALDCFS
SEELDIPMDYSPLGFGGTGTVIVLTEEDDIVEAALKIAEFYEHETCGQCT
PCRVGCYEQANLLEKIYKGEATEQDWEGFDFVNRNIQPTSICGLGAVAGR
LIRQTLEKFPEEWEKYRK

3D structure

• PDB: 8qg1 Structures of 3-acetylpyridine adenine dinucleotide and ADP-ribose bound to the electron input module of respiratory complex I.
• Chain: D
• Resolution: 2.0 Å

Enzymatic activity

• Enzyme Commision number: 7.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	D	P199 T346 C347 G348 Q349 C350 C353 I392 C393 L395 G396	P198 T345 C346 G347 Q348 C349 C352 I391 C392 L394 G395
BS02	FMN	D	G65 G67 K76 N92 D94 E95 Y180 G183 E184 N219 N220 T223	G64 G66 K75 N91 D93 E94 Y179 G182 E183 N218 N219 T222
BS03	APR	D	G68 A69 F71 K76 F79 E185 K202 Y205	G67 A68 F70 K75 F78 E184 K201 Y204

Gene Ontology

Molecular Function

• GO:0008137 NADH dehydrogenase (ubiquinone) activity
• GO:0010181 FMN binding
• GO:0046872 metal ion binding
• GO:0048038 quinone binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:1902600 proton transmembrane transport

External links

• PDB: RCSB:8qg1, PDBe:8qg1, PDBj:8qg1
• PDBsum: 8qg1
• PubMed: 38503292
• UniProt: O66841|NUOF_AQUAE NADH-quinone oxidoreductase subunit F (Gene Name=nuoF)