Structure of PDB 8prm Chain D |
>8prmD (length=79) Species: 309799 (Dictyoglomus thermophilum H-6-12) [Search protein sequence] |
TGGSVHSSPAIGQDGTIYVGSNDHYLYAINPNGKLKWKFETGGSVHSSPA IGQDGTIYVGSNDHYLYAINPNGKLKWKF |
|
PDB | 8prm The structure of v13Bagel2 |
Chain | D |
Resolution | 2.2 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
IR0 |
D |
H6 N22 H46 N62 |
H6 N22 H46 N62 |
|
|
|