Structure of PDB 8pp6 Chain D

Receptor sequence
>8pp6D (length=94) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
KRKESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLA
HYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
3D structure
PDB8pp6 Structural basis of the histone ubiquitination read-write mechanism of RYBP-PRC1.
ChainD
Resolution3.18 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D R30 K31 Y37 R2 K3 Y9
BS02 dna D Y39 R83 T85 Y11 R55 T57
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0044877 protein-containing complex binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pp6, PDBe:8pp6, PDBj:8pp6
PDBsum8pp6
PubMed38528151
UniProtP02283|H2B_DROME Histone H2B (Gene Name=His2B)

[Back to BioLiP]