Structure of PDB 8ovj Chain D

Receptor sequence
>8ovjD (length=160) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]
NPMREIVVKKLCINICVGESGDRLTRASKVLEQLCEQTPVLSRARRNEKI
AVHCTVRGKKAEELLEKGLKVKEFELKSYNFADTGSFGFGIDEHIDLGIK
YDPSTGIYGMDFYVVLGRRGERVAHRKRKCSRVGHSHHVTKEEAMKWFEK
VHDGIIFQAK
3D structure
PDB8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
ChainD
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D N9 M11 R12 Q45 T46 T72 R74 G137 R139 R143 S148 G151 H154 N1 M3 R4 Q37 T38 T55 R57 G120 R122 R126 S131 G134 H137
BS02 rna D K18 N22 C24 A52 Y96 N97 A99 D100 G105 F106 G126 M127 Y130 K10 N14 C16 A44 Y79 N80 A82 D83 G88 F89 G109 M110 Y113
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ovj, PDBe:8ovj, PDBj:8ovj
PDBsum8ovj
PubMed38722744
UniProtP48157|RL11_LEIMA Large ribosomal subunit protein uL5 (Gene Name=RPL11)

[Back to BioLiP]