Structure of PDB 8ouz Chain D

Receptor sequence
>8ouzD (length=234) Species: 9606 (Homo sapiens) [Search protein sequence]
GRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPK
SEGGLEVEVLFIDTDYHFDMLRLVTILEHRLSQSSEEIIKYCLGRFFLVY
CSSSTHLLLTLYSLESMFCSHPSLCLLILDSLSAFYWIDRVNGGESVNLQ
ESTLRKCSQCLEKLVNDYRLVLFATTQTIMQDYRPYLCKAWQQLVKHRMF
FSKQNQFSLVSRCLKSNSLKKHFFIIGESGVEFC
3D structure
PDB8ouz Structure and function of the RAD51B-RAD51C-RAD51D-XRCC2 tumour suppressor.
ChainD
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP D E50 G51 G53 K54 T55 R91 I272 G273 E274 E31 G32 G34 K35 T36 R72 I226 G227 E228
Gene Ontology
Molecular Function
GO:0000400 four-way junction DNA binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0140664 ATP-dependent DNA damage sensor activity
Biological Process
GO:0000278 mitotic cell cycle
GO:0000724 double-strand break repair via homologous recombination
GO:0001701 in utero embryonic development
GO:0001756 somitogenesis
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0006974 DNA damage response
GO:0007098 centrosome cycle
GO:0010165 response to X-ray
GO:0010332 response to gamma radiation
GO:0022008 neurogenesis
GO:0035264 multicellular organism growth
GO:0042148 DNA strand invasion
GO:0043524 negative regulation of neuron apoptotic process
GO:0050769 positive regulation of neurogenesis
GO:0051321 meiotic cell cycle
GO:2000269 regulation of fibroblast apoptotic process
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005657 replication fork
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005856 cytoskeleton
GO:0033063 Rad51B-Rad51C-Rad51D-XRCC2 complex
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ouz, PDBe:8ouz, PDBj:8ouz
PDBsum8ouz
PubMed37344587
UniProtO43543|XRCC2_HUMAN DNA repair protein XRCC2 (Gene Name=XRCC2)

[Back to BioLiP]