Structure of PDB 8ott Chain D

Receptor sequence
>8ottD (length=93) Species: 9606 (Homo sapiens) [Search protein sequence]
SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLA
HYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
3D structure
PDB8ott Cooperation between bHLH transcription factors and histones for DNA access.
ChainD
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D S32 R33 Y42 G53 I54 S55 S56 R86 S87 T88 S1 R2 Y11 G22 I23 S24 S25 R55 S56 T57
BS02 dna D R33 K34 Y40 R2 K3 Y9
BS03 PTD D K43 K46 K12 K15
BS04 PTD D H82 K85 H51 K54
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8ott, PDBe:8ott, PDBj:8ott
PDBsum8ott
PubMed37407816
UniProtP06899|H2B1J_HUMAN Histone H2B type 1-J (Gene Name=H2BC11)

[Back to BioLiP]