Structure of PDB 8om4 Chain D

Receptor sequence

>8om4D (length=341) Species: 4932 (Saccharomyces cerevisiae)

PRKANLLKSLARGRVRTSFNKYNLFNLYKKGGVDLKSKSLYQQKWTAKQE
TRAYHGEHLTEKRWQTVFKPKLDSVAQLDASLRGGEIKETPFLLQTFAVL
EKRLDFALFRAMFASSVRQARQFILHGNVRVNGVKIKHPSYTLKPGDMFS
VKPDKVLEALGAKKPSFQEALKIDKTQIVLWNKYVKEAKTEPKEVWEKKL
ENFEKMSDSNPKKLQFQEFLRQYSLTFDPKWAKNLKYHDPIKLSELEGDE
PKARKLINLPWQKNYVYGRQDPKKPFFTPWKPRPFLSPFAILPHHLEISF
KTCHAVYLRDPVARPGQSEVISPFDVPVHERAYMYYLRNGK

3D structure

• PDB: 8om4 METTL17 is an Fe-S cluster checkpoint for mitochondrial translation.
• Chain: D
• Resolution: 2.32 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	P2 L7 K9 S10 L11 R13 N21 K22 Y23 Y42 Q43 K45 W46 K49 Q50 T61 E62 K63 R64 S116 S117 R119 Q120 R122 Q123 L126 H127 R131 G134 E159 K164 K165 S167 E170 T177 V180 L181 W182 N183 K184 Y185 K187 W197 K200 K213 F220 Y224 D373 W376 L380 K381 Y382 H383 P385 N403 L404 P405 W406 K408 R428 M479 R483 N484 K486	P1 L6 K8 S9 L10 R12 N20 K21 Y22 Y41 Q42 K44 W45 K48 Q49 T60 E61 K62 R63 S115 S116 R118 Q119 R121 Q122 L125 H126 R130 G133 E158 K163 K164 S166 E169 T176 V179 L180 W181 N182 K183 Y184 K186 W196 K199 K212 F219 Y223 D228 W231 L235 K236 Y237 H238 P240 N258 L259 P260 W261 K263 R283 M334 R338 N339 K341

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0032543 mitochondrial translation
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8om4, PDBe:8om4, PDBj:8om4
• PDBsum: 8om4
• PubMed: 38199006
• UniProt: P27929|NAM9_YEAST Small ribosomal subunit protein uS4m (Gene Name=NAM9)