Structure of PDB 8kbc Chain D |
>8kbcD (length=131) Species: 1392497 (Clostridioides mangenotii LM2) [Search protein sequence] |
SGLVPRGSHMEIKNGLCTQKYTKVYAEDKEKWKFNAPHHFIVGKADCEDE YIEPIEYVNFQEGPIKEYGINGVNNEDLILMVITRLQAFQDSPYKCRENA MAITKLQECLMWLGKRTLDREVKGIEGTSEI |
|
PDB | 8kbc Structure of CmTad1 complexed with cAAA |
Chain | D |
Resolution | 2.8 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
D |
R88 A91 M92 T95 |
R97 A100 M101 T104 |
|
|
|