Structure of PDB 8jyq Chain D

Receptor sequence

>8jyqD (length=171) Species: 10090 (Mus musculus)

QVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVSWIRQPSGKGLEWL
AHIFWDDDKRYNPSLKSRLTISKDTSRNKVFLKITSVDTADTATYYCARR
VVATDWYFDVWGAGTTVTVCSGSDYEFLKSWTVEDLQKRLLALDPMMEQE
IEEIRQKYQSKRQPILDAIEA

3D structure

• PDB: 8jyq Locally misfolded HER2 expressed on cancer cells is a promising target for development of cancer-specific antibodies
• Chain: D
• Resolution: 1.75 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	D	S23 R75 K77	S23 R77 K79
BS02	peptide	D	G31B F52 D54 D56 R58 R95 V97 A98 W100A	G33 F54 D56 D58 R60 R100 V102 A103 W106

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Dec 2 07:59:13 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8jyq', asym_id = 'D', title = 'Locally misfolded HER2 expressed on cancer cells...get for development of cancer-specific antibodies'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8jyq', asym_id='D', title='Locally misfolded HER2 expressed on cancer cells...get for development of cancer-specific antibodies')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004674,0007165,0051262', uniprot = '', pdbid = '8jyq', asym_id = 'D'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004674,0007165,0051262', uniprot='', pdbid='8jyq', asym_id='D')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>